GRIFN_RAT   O88644


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88644

Recommended name:Grifin

EC number:

Alternative names:

Cleaved into:

GeneID:117130

Gene names  (primary ):Grifin

Gene names  (synonym ):

Gene names  (ORF ):

Length:144

Mass:15,839

Sequence:MALQFEAFCAGGLAPGWSLTVQGHADAGEDKFEINFLTDAGDIAFHVKPRFSSATVVGNAFQGGRWGQEEVSSVFPLTLGEPFEVEVSADTEHFHIYAQEQKVLQFPHRHRPLATITRVRVLSDHQLAQVELAKRGLSWGDGGY

Tissue specificity:Lens-specific. Located at the interface between lens fiber cells (at protein level). 1

Induction:

Developmental stage:Increases during lens maturation (at protein level). 1

Protein families:


   💬 WhatsApp