TR117_RAT   Q675B8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q675B8

Recommended name:Taste receptor type 2 member 117

EC number:

Alternative names:Taste receptor type 2 member 39 (T2R39)

Cleaved into:

GeneID:100310880

Gene names  (primary ):Tas2r117 By Similarity

Gene names  (synonym ):T2r39

Gene names  (ORF ):

Length:318

Mass:37,090

Sequence:MQHNLKTIFVISHSTLTIILFTELVTGIIGNGFMALVHCMDWLRRKKISLVNQILTALAISRIFQLCLLFISLVISFSYPDLTTTSLIKVTCNLWIIVNHFNIWLATCLGIFYFLKISNFSNSLFLYLKWRVEKVVLVTLLVSLVLLTLNSLLINLEINICINEYQRNITYSFNSYYHANCHRQMLSLHIIFLSVPFVLSLSTFLLLIFSLGTHHKKMQQHVQGRRDASTMAHFKALQTVIAFLLLYSIFILSVLVQIWKYELLKKNLFILFCQVAYVAFPSFHSYILILGDMKMRQACLSVLWWQKFRKNYVEPLDL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp