TR117_RAT Q675B8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q675B8
Recommended name：Taste receptor type 2 member 117
EC number：
Alternative names：Taste receptor type 2 member 39 (T2R39)
Cleaved into：
GeneID：100310880
Gene names (primary )：Tas2r117 By Similarity
Gene names (synonym )：T2r39
Gene names (ORF )：
Length：318
Mass：37,090
Sequence：MQHNLKTIFVISHSTLTIILFTELVTGIIGNGFMALVHCMDWLRRKKISLVNQILTALAISRIFQLCLLFISLVISFSYPDLTTTSLIKVTCNLWIIVNHFNIWLATCLGIFYFLKISNFSNSLFLYLKWRVEKVVLVTLLVSLVLLTLNSLLINLEINICINEYQRNITYSFNSYYHANCHRQMLSLHIIFLSVPFVLSLSTFLLLIFSLGTHHKKMQQHVQGRRDASTMAHFKALQTVIAFLLLYSIFILSVLVQIWKYELLKKNLFILFCQVAYVAFPSFHSYILILGDMKMRQACLSVLWWQKFRKNYVEPLDL
Tissue specificity：
Induction：
Developmental stage：
Protein families：