ATPMK_RAT Q9JJW3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJW3
Recommended name：ATP synthase F(0) complex subunit k, mitochondrial Curated
EC number：
Alternative names：
Cleaved into：
GeneID：171069
Gene names (primary )：Atp5mk
Gene names (synonym )：Atp5md Imported, Dapit, Usmg5
Gene names (ORF )：
Length：58
Mass：6,408
Sequence：MAGPESDGQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRPKKTPAVKAT
Tissue specificity：Ubiquitous. Highly expressed in skeletal and cardiac muscle. Moderately expressed in brain, thymus, stomach and testis. Lowest expression levels were detected in lung, liver, kidney, adrenal gland, spleen, small intestine and adipose tissue. In streptozotocin-induced diabetes, the insulin-sensitive tissues skeletal and cardiac muscle were down-regulated. 1
Induction：
Developmental stage：
Protein families：