SPT19_RAT Q920Q3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920Q3
Recommended name：Spermatogenesis-associated protein 19, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：171403
Gene names (primary )：Spata19
Gene names (synonym )：Spas1, Spergen1
Gene names (ORF )：
Length：154
Mass：18,041
Sequence：MIITTWIMYILARKSIGLPFPPRVNSDIEVEETEAVSVVQHWLNKTEEEASRSIKEKISINDPCTQGHDIHVTRDLVKHRLSKCDMLTDPNQEVLEERTRIQFIRWSHTRIFQVPSEMMDDVIQERIDQVRRSVSHLRCDSSSDPCYRNSCSEC
Tissue specificity：Expressed in the testis. 1
Induction：
Developmental stage：
Protein families：