NPB_RAT   Q8K4P2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K4P2

Recommended name:Neuropeptide B

EC number:

Alternative names:Neuropeptide B-29 (NPB29) Alternative names: L7C

Cleaved into:

GeneID:259222

Gene names  (primary ):Npb

Gene names  (synonym ):

Gene names  (ORF ):

Length:119

Mass:13,019

Sequence:MVRCRTLVAAALALLLTPALAWYKPAAGSHHYSVGRAAGLLSSFHRFPSTRRSESPALRVGTVPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHKAECQSA

Tissue specificity:Detected in a variety of tissues. High levels are found in the lymphoid organs, central nervous system, mammary gland and uterus.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp