CCD50_RAT   Q810U0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810U0

Recommended name:Coiled-coil domain-containing protein 50

EC number:

Alternative names:

Cleaved into:

GeneID:288022

Gene names  (primary ):Ccdc50

Gene names  (synonym ):C3orf6h

Gene names  (ORF ):

Length:305

Mass:35,158

Sequence:MADVSVDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNIQRNRLVQHDLQVAKQLQEEDLKAQAQLQKRYKALEQHDCEIAQEIQEKLTIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHTPEFSGGSASGDNYYYEDGGMKSRGINEAVSAPARVSHRDQEWYDAEIARKLQEEELLATHMDIRAAQVAQDEEIARLLMAEEKKAYKKAKDREKSSLDKRKHDYDCKSKAKSAHSKSKEGDETQRAKIDRPSRPPPPAAMAPEDVDPTHFTNQHSNTRHFSKSESSHKGFHNKQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp