EMC10_RAT Q6AYH6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6AYH6
Recommended name：ER membrane protein complex subunit 10
EC number：
Alternative names：
Cleaved into：
GeneID：292878
Gene names (primary )：Emc10
Gene names (synonym )：Inm02
Gene names (ORF )：
Length：258
Mass：26,968
Sequence：MVAAGAGVTQLLVLLLMVAAVPSRARGSGCRVGAAARGVGADGHEAEGCGTVALLLEHSFEIGDGANFQKRGSLLWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRVRVPRRPGTLDGSEAGGHVSSFVPACSLVESHLSDQLTLHVDVAGNVVGLSVVVYPGGCRGSEVEDEDLELFNTSVHLRPPGTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDAGGQGGGGGGGSSR
Tissue specificity：Broadly expressed, with highest levels in pancreatic islets, testis and bladder. Present in the islets of Langerhans (at protein level). 1
Induction：
Developmental stage：By glucose in pancreatic islets. 1
Protein families：