JUPI1_RAT   Q6AXU6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AXU6

Recommended name:Jupiter microtubule associated homolog 1 By Similarity

EC number:

Alternative names:Jupiter microtubule associated homolog 1, N-terminally processed

Cleaved into:

GeneID:287828

Gene names  (primary ):Jpt1 By Similarity

Gene names  (synonym ):Hn1 Imported

Gene names  (ORF ):

Length:149

Mass:15,575

Sequence:MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENPPSWAKSAGGREDSESPGTQRSNSSEASSGDFLDLKGESDVHENVDTDFQASLAQVEEKPVPAAPVPSPVAPAPAPSRRNPPGGKSSLVLG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp