TXND8_RAT   Q69AB1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q69AB1

Recommended name:Thioredoxin domain-containing protein 8

EC number:

Alternative names:

Cleaved into:

GeneID:362525

Gene names  (primary ):Txndc8

Gene names  (synonym ):Sptrx3

Gene names  (ORF ):

Length:127

Mass:14,569

Sequence:MVQKIKSMREFKELLGAAGNRLVVVEFSAQWCGPCKMIAPAFQAMSLQYRNVMFAQVDVDSSQELTEHCSIQVVPTFQMFKHSRKVTPFSRLKRILCCFRSGPGSKKIFEFQGADIEKLEEKIQELM

Tissue specificity:Testis-specific. Expressed in spermatozoa, sperm tail, elongated and round spermatids. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp