TR129_RAT   Q67ES6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q67ES6

Recommended name:Taste receptor type 2 member 129

EC number:

Alternative names:Taste receptor type 2 member 24 (T2R24)

Cleaved into:

GeneID:100310881

Gene names  (primary ):Tas2r129 By Similarity

Gene names  (synonym ):T2r24

Gene names  (ORF ):

Length:315

Mass:37,033

Sequence:MDGIIQIISAFIVIIEIIIGWFGNGFIVLVNCMHWIKRRRISTVNQILTALAFSRIYLLLTVFTVILASVQYSNILVTRREVKVIIFHLITSNHFSMWLAACLGLFYFLKIANFSNFIFVFLKKRVNKVVSGTLLMSLVFLFLNTLLINSYIDAQIDDYRGYLLYDFTSNITVSFYRVILVINNCIFTSIPFALSQSTFLMLIFSLWRHYKKMQQHAQRCRDTLTNAHIKVLQTMIMYVLLSAIFFLFLSMQIWRNKLMENILFIRFCETVAAVFPSGHSCVLIWGDTNLRQTFLSVLWWLKHRFTLWVPKLYCR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp