TR129_RAT Q67ES6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q67ES6
Recommended name：Taste receptor type 2 member 129
EC number：
Alternative names：Taste receptor type 2 member 24 (T2R24)
Cleaved into：
GeneID：100310881
Gene names (primary )：Tas2r129 By Similarity
Gene names (synonym )：T2r24
Gene names (ORF )：
Length：315
Mass：37,033
Sequence：MDGIIQIISAFIVIIEIIIGWFGNGFIVLVNCMHWIKRRRISTVNQILTALAFSRIYLLLTVFTVILASVQYSNILVTRREVKVIIFHLITSNHFSMWLAACLGLFYFLKIANFSNFIFVFLKKRVNKVVSGTLLMSLVFLFLNTLLINSYIDAQIDDYRGYLLYDFTSNITVSFYRVILVINNCIFTSIPFALSQSTFLMLIFSLWRHYKKMQQHAQRCRDTLTNAHIKVLQTMIMYVLLSAIFFLFLSMQIWRNKLMENILFIRFCETVAAVFPSGHSCVLIWGDTNLRQTFLSVLWWLKHRFTLWVPKLYCR
Tissue specificity：
Induction：
Developmental stage：
Protein families：