GPX6_RAT Q64625
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64625
Recommended name:Glutathione peroxidase 6
EC number:EC:1.11.1.9
Alternative names:GPx-6; GSHPx-6
Cleaved into:
GeneID:259233
Gene names (primary ):Gpx6
Gene names (synonym ):
Gene names (ORF ):
Length:221
Mass:24,961
Sequence:MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ
Tissue specificity:Expressed in the Bowman glands.
Induction:
Developmental stage:
Protein families: