HAP28_RAT Q62785
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62785
Recommended name:28 kDa heat- and acid-stable phosphoprotein
EC number:
Alternative names:
Cleaved into:
GeneID:64527
Gene names (primary ):Pdap1
Gene names (synonym ):Haspp28
Gene names (ORF ):
Length:181
Mass:20,605
Sequence:MPKGGRKGGHKGRVRQYTSPEEIDAQLQAEKQKANEEDEQEEGGDGASGDPKKEKKSLDSDESEDEDDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
Tissue specificity:Present in all tissues tested, including brain, lung, spleen, kidney, liver, heart, and muscle, in decreasing order of abundance.
Induction:
Developmental stage:
Protein families: