P5CR3_RAT   Q5PQJ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5PQJ6

Recommended name:Pyrroline-5-carboxylate reductase 3 Imported

EC number:EC:1.5.1.2

Alternative names:P5C reductase 3; P5CR 3

Cleaved into:

GeneID:300035

Gene names  (primary ):Pycr3

Gene names  (synonym ):Pycrl

Gene names  (ORF ):

Length:274

Mass:28,878

Sequence:MADEMSEPRRVGFVGAGRMAEAIAQGLIRAGKVEAKQVLASAPTDKNLCHFRALGCQTTHSNHEVLQNCPLVIFATKPQVLPAVLAEVAPVVTTEHIIVSVAAGISLSSMEELLPPKTRVLRVSPNLPCVVQEGAMVMTRGHHAGNEDAKLLQNLLEACGQCIEVPESYVDIHTGLSGSGVAFVCTFSEALAEGAIKMGMPSDLAHRIAAQTLLGTAKMLQQEGKHPAQLRTDVLTPAGTTIHGLHALEQGGFRAAAMSAVEAATCRAKELSKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp