RNS10_RAT   Q5GAM0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5GAM0

Recommended name:Inactive ribonuclease-like protein 10

EC number:

Alternative names:

Cleaved into:

GeneID:305840

Gene names  (primary ):Rnase10

Gene names  (synonym ):

Gene names  (ORF ):

Length:212

Mass:23,531

Sequence:MKVTLVHLLFMMLLLLLGLGVGLGLGLHMAAAILENQPLDEFWPSDSQDTAEATEEGQGTRTTEALVLDNKEMAVPVWSEDTVLSEDEVGGSRMLRAKTLLQSKQGYLKFDLNIRDCNVMMAHKIKEHNQSCINDYTFIHEDPSTVGAVCNSPLVDCDLKGGKCHKSPRPFDLTLCKLAKPGQVTPNCHYLTYITEKVIIITCNNTKQLEIK

Tissue specificity:Male-specific expression in proximal caput of the epididymis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp