T2R38_RAT Q4VHE7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4VHE7
Recommended name：Taste receptor type 2 member 38
EC number：
Alternative names：Taste receptor type 2 member 138 Taste receptor type 2 member 26 (T2R26)
Cleaved into：
GeneID：500091
Gene names (primary )：Tas2r38
Gene names (synonym )：T2r38 Imported, Tas2r138 Imported, Tas2r26
Gene names (ORF )：
Length：331
Mass：37,233
Sequence：MLTLTPVLTVSYEAKISFLFLSVVEFAVGIMANAFIVLVNFWDMVKKQPLNNCDIALLCLSITRLFLQGLLLLDAIQLACFQQMKDPLSHNYQAILTLWMSANQVSLWLAACLSLLYCAKIVRFSHTFPLHLASWVSRRFLQMLLVALLFSGVCTALCLWDFFSRSHTVVTSMLHMNNTEFNLQIEKLNFFYSFVFCNVGSVPPSLVFLISSGVLVISLGNHMRTMKSQTRGSRDPSLEAHVRAIIFLVSFLCFYVVSFCAALISIPLLVLWHNKGGVMVCIGMMAACPSGHAAILISGNAKLKKVIVTILFWFQSRQKVRRVHKVLPRIL
Tissue specificity：Expressed in tongue, stomach and duodenum. 1
Induction：
Developmental stage：
Protein families：