MCTS1_RAT   Q4G009


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4G009

Recommended name:Malignant T-cell-amplified sequence 1

EC number:

Alternative names:

Cleaved into:

GeneID:302500

Gene names  (primary ):Mcts1

Gene names  (synonym ):

Gene names  (ORF ):

Length:182

Mass:20,550

Sequence:MGKGRFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Tissue specificity:

Induction:

Developmental stage:

Protein families:MCTS1 family


   💬 WhatsApp