DBIL5_RAT   P56702


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56702

Recommended name:Diazepam-binding inhibitor-like 5

EC number:

Alternative names:

Cleaved into:

GeneID:59116

Gene names  (primary ):Dbil5

Gene names  (synonym ):

Gene names  (ORF ):

Length:87

Mass:9,864

Sequence:MSQVEFEMACASLKQLKGPLSDQEKLLVYSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKGMSKMDAMRIYIAKVEELKKNETC

Tissue specificity:Testis.

Induction:

Developmental stage:Specifically expressed in late haploid male germ cells.

Protein families:


   💬 WhatsApp