ST2A2_RAT P50235
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50235
Recommended name：Sulfotransferase 2A2 1 Publication
EC number：EC:2.8.2.2
Alternative names：ST2A2
Cleaved into：
GeneID：361510
Gene names (primary )：Sult2a2
Gene names (synonym )：
Gene names (ORF )：
Length：285
Mass：33,531
Sequence：MMSDYTWFEGIPFPAFWFSKEILENSCKKFVVKEDDLIILTYPKSGTNWLIEIVCLIQTKGDPKWIQSMPIWDRSPWIETGSGYDKLTKMEGPRLMTSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSAYFFWSKIALEKKPDSLGTYVEWFLKGNVAYGSWFEHIRGWLSMREWDNFLVLYYEDMKKDTMGSIKKICDFLGKKLEPDELNLVLKYSSFQVVKENNMSNYSLMEKELILTGFTFMRKGTTNDWKNHFTVAQAEAFDKVFQEKMAGFPPGMFPWE
Tissue specificity：Detected in liver. 1
Induction：
Developmental stage：Induced by estrogens and suppressed by androgens. Expression is under the influence of pituitary growth hormone and thyroid hormone.
Protein families：