GUC2A_RAT P28902
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28902
Recommended name：Guanylin
EC number：
Alternative names：
Cleaved into：
GeneID：25656
Gene names (primary )：Guca2a
Gene names (synonym )：Guca2
Gene names (ORF )：
Length：115
Mass：12,574
Sequence：MNAWLLSVLCLLGALAVLVEGVTVQDGDLSFPLESVKQLKHLREVQEPTLMSHKKFALRLPKPVAPELCSQSAFPEALRPLCEKPNAEEILQRLEAIAQDPNTCEICAYAACTGC
Tissue specificity：Intestine and in low abundance in adrenal gland, kidney, and uterus/oviduct.
Induction：
Developmental stage：
Protein families：