UDB37_RAT P19488
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19488
Recommended name：UDP-glucuronosyltransferase 2B37
EC number：EC:2.4.1.17
Alternative names：UDPGT 2B37
Cleaved into：
GeneID：
Gene names (primary )：Ugt2b37
Gene names (synonym )：Ugt2b5, Ugt2b6
Gene names (ORF )：
Length：530
Mass：60,593
Sequence：MPGKWIFALLLLQISFCLRSAKCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSAYYVLDPKKSPDLKFETFPTSVSKDELEKYFIKLADAWTYELQRDTCLSFSPLLQNMMDEFSDYYLSVCKDAVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRASPGHKIEKSSGRFILPPSYVPVILSGLGGQMTFIDRVKNMICMLYFDFWFHMFNAKNWDPFYTEILGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCKPAKPLPKDIEDFVQSSGEHGVVVFSLGSMVSSMTEEKANAIAWALAQIPQKVLWKFDGKIPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHGGANGVYEAIYHGIPMIGIPMFGEQHDNIAHMVAKGAAVTLNIRTMSKSDLFNALKEVINNPFYKKNAMWLSTIHHDQPMKPLDKAIFWIEYVMRHKRAKHLRPLGHNLPWYQYHSLDVIGFLLACLAVIAALAVKCFLFIYRFFAKKQKKMKNE
Tissue specificity：Constitutively expressed.
Induction：
Developmental stage：
Protein families：