PSC1_RAT P02782
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02782
Recommended name：Prostatic steroid-binding protein C1
EC number：
Alternative names：
Cleaved into：
GeneID：309203
Gene names (primary )：Psbpc1
Gene names (synonym )：Scgb1d2
Gene names (ORF )：
Length：111
Mass：12,763
Sequence：MSTIKLSLCLLIMLAVCCYEANASQICELVAHETISFLMKSEEELKKELEMYNAPPAAVEAKLEVKRCVDQMSNGDRLVVAETLVYIFLECGVKQWVETYYPEIDFYYDMN
Tissue specificity：
Induction：
Developmental stage：
Protein families：