FA81A_RAT D4A7T8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4A7T8
Recommended name：Protein FAM81A Curated
EC number：
Alternative names：
Cleaved into：
GeneID：315789
Gene names (primary )：Fam81a
Gene names (synonym )：
Gene names (ORF )：
Length：364
Mass：41,856
Sequence：MHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVSSLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDHLSLIVKENSGASERDMEKKLTQMSARLDKIEESQRRNAEGQRKPEEEKVHGRISKLELQMTEDMKEMKAEVNAGFTAIYESIGSLRQVLEAKMKLDRDQLQKQIQQMQKPESSM
Tissue specificity：Highly expressed in brain (at protein level). 1
Induction：
Developmental stage：In brain, expression increases with age, peaking in the adult (at protein level). 1
Protein families：