TR110_RAT Q9JKE8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKE8
Recommended name：Taste receptor type 2 member 110
EC number：
Alternative names：Taste receptor type 2 member 10 (T2R10)
Cleaved into：
GeneID：100310875
Gene names (primary )：Tas2r110
Gene names (synonym )：Tas2r10
Gene names (ORF )：
Length：333
Mass：38,406
Sequence：MFLHTIKQRDIFTLIIIFFVEITMGILGNGFIALVNIVDWIKRRRISSVDKILTTLALTRLIYAWSMLIFILLFILGPHLIMRSEILTSMGVIWVVNNHFSIWLATCLGVFYFLKIANFSNSLFLYLKWRVKKVVLMIIVVSLIFLILNIFSLEIYDHFSIDVYEGNMSYSLGDSTHFPRIFLFANSSKVFLITNSSQVFLPINSLFMLIPFTVSLVAFFMLIFSLWKHHKKMEVNAKGPRDASTTAHIKALQTGLSFLLLYAIYLLFIVIGILSHKFMGGKLILIFDHICAIVFPISHSFVLILGNSKLRRSTLSVLRFLRCRSKHIHIMDP
Tissue specificity：Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae. 1
Induction：
Developmental stage：
Protein families：