SG11A_RAT Q8VBV2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VBV2
Recommended name：Sperm-associated antigen 11A Imported
EC number：
Alternative names：
Cleaved into：
GeneID：246305
Gene names (primary )：Spag11a
Gene names (synonym )：Bin1b Imported, Ep2 By Similarity, Spag11 Imported
Gene names (ORF )：
Length：68
Mass：7,799
Sequence：MKVLLLFAVFFCLVQRNSGDIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
Tissue specificity：Only expressed in epididymis (middle part of the caput). 1
Induction：
Developmental stage：Its expression starts at 30 days of age, reaches a maximum during the sexually mature period, and then decreased in old rats. 1
Protein families：