QTGAL_RAT   Q6GV29


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6GV29

Recommended name:Queuosine-tRNA galactosyltransferase Curated

EC number:EC:2.4.1.-

Alternative names:QTGAL Curated

Cleaved into:

GeneID:

Gene names  (primary ):B3gntl1

Gene names  (synonym ):Qtgal By Similarity

Gene names  (ORF ):

Length:357

Mass:40,711

Sequence:MQLPEDATKRAPLALVSIILPVHNAEQWLDECLMSVLQQDFEGTMELSVFNDASKDKSRAIIEKWKVKLEDSGISVVIGGHDSPSPRGVGYSKNQAIAQSTGSYLCFLDSDDVMMPQRVRMQYEAAVQHPASIIGCQVRRDPPDSTERYTRWINQLTSDQLLTQVFTSHGPTVIMPTWFCSRAWFSHVGPFDEGGQGVPEDLLFFYEHLRKGGGVFRVDHSLLLYRYHLCAATHSVLEMTIWTHRVHFLEEQILPHWKSFTIWNAGKQGRKLYRSLTAASQHKVVAFCDIDKNKIRKGFYCHEDSQERPKPKVPILHFQAAQPPFVICVKLDLTGGEFEDNLKSLHLQEGRDFVHFS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp