PCGF1_RAT   Q6DLV9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6DLV9

Recommended name:Polycomb group RING finger protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:312480

Gene names  (primary ):Pcgf1

Gene names  (synonym ):Nspc1

Gene names  (ORF ):

Length:243

Mass:28,782

Sequence:MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIRDFYQSRGLDRVSQPSGEEPALRGLGLPFTSFDHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKEKRR

Tissue specificity:Highly expressed in brain, cerebellum, heart and testis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp