PHF23_RAT   Q6AY75


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AY75

Recommended name:PHD finger protein 23 By Similarity

EC number:

Alternative names:

Cleaved into:

GeneID:360550

Gene names  (primary ):Phf23 By Similarity

Gene names  (synonym ):

Gene names  (ORF ):

Length:334

Mass:36,232

Sequence:MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKGAPDSATLLEKMKLKDSLFDLDGPKVASPLSPTSLTSRPPAALTPVPLSQGDLSQPRKKDRKNRKLGPGGGAGFGVLRRPRPAPGDGEKRSRIKKSKKRKLKKADRGDRLPPPGPPRAPPSDTDSEEEEEEEEEEDDEEETTVVGGGGVPAPVLPTPPEAPRPPVTVHPEGAPPTDSEGKDAGSTETSQDGDGSSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCGTWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRLGGLPKSGEP

Tissue specificity:

Induction:

Developmental stage:

Protein families:PHF23 family


   💬 WhatsApp