TR134_RAT Q67ES7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q67ES7
Recommended name：Taste receptor type 2 member 134
EC number：
Alternative names：Taste receptor type 2 member 23 (T2R23)
Cleaved into：
GeneID：295589
Gene names (primary )：Tas2r134
Gene names (synonym )：Tas2r23, Tas2r34
Gene names (ORF )：
Length：329
Mass：38,062
Sequence：MRCSLRGCVQGRGGKSGVSLSKFSPKKMSFFFIFMVIFCIQSLVALLQNGFLATVLGREWVRSQGLPAGDMIVACLAASRFCLHGVAIVNNFLTFVKLWSQKIYFSVLWDFVNTVNFWCTTWLAIFYCVKISSFSHPIFFWIKWRISRSVPRLLLGSLVIGGLSAVSSATGNTIAFQMTACENYTLAYRTRAFYAYYFRCHAMLMWIIPFFLFLLSVILLMFSLYRHLEHMRYRRPWSHDYSTQAHTMALKSLAFFLVFYTSYVLFLVISVTRVVNVHSSWHWAWEVITYMGILLHSTILTLSNPKMRKALKIKFPDLCVARSQDKRRG
Tissue specificity：Expressed in tongue and gastrointestinal tract. 1
Induction：
Developmental stage：
Protein families：