SPR1A_RAT Q63532
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63532
Recommended name:Cornifin-A
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Sprr1a
Gene names (synonym ):Spr, Sprr1
Gene names (ORF ):
Length:152
Mass:16,734
Sequence:MSSQQQKQPCTVPPQLHQHEVKQPCQPPPQEPCAPKTKEPCHPIPEPCNPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCHPKAPEPCHPVVPEPCQPVAPEPCQPVVPEPCPPTVTPSPYQQKTKQK
Tissue specificity:In squamous epithelia lining the nasal vestibule and in the hard palate.
Induction:
Developmental stage:During squamous metaplasia induced by cigarette smoke exposure.
Protein families: