AKCL2_RAT   Q5U1Y4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5U1Y4

Recommended name:1,5-anhydro-D-fructose reductase

EC number:EC:1.1.1.263

Alternative names:AF reductase

Cleaved into:

GeneID:307091

Gene names  (primary ):Akr1e2

Gene names  (synonym ):Akr1cl2

Gene names  (ORF ):

Length:301

Mass:34,500

Sequence:MHQIPTVGLGTWKASPGEVTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEKIKEGVVKRDELFIVSKLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWPMGFKPGDKDIPLDRSGKVIPSHTSFLDTWEAMEDLVIEGLVKNIGVSNFNHEQLDRLLNKPGLRIKPITNQIECHPYLNQKSLIDFCHGRNVSVTAYRPLGGSRDGVHLMDDIVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVNPSRIRENIQVFDFELTEKDMEELLSLDKNLRLATFPSTENHKDYPFHIEY

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp