DRAM2_RAT   Q5BK09


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BK09

Recommended name:DNA damage-regulated autophagy modulator protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:362011

Gene names  (primary ):Dram2

Gene names  (synonym ):Tmem77

Gene names  (ORF ):

Length:267

Mass:30,173

Sequence:MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTMPPERCLFGVMLNIAAVLGIATIYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSALFIVHVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSILYSSDFGADIVQKLHWNPEDKGYVLHIVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEANLHGLTLYDTVPCPVTNERTPLLSRDFQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp