TMT1B_RAT   Q562C4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q562C4

Recommended name:Thiol S-methyltransferase TMT1B

EC number:EC:2.1.1.9

Alternative names:Associated with lipid droplet protein 1 (ALDI) Methyltransferase-like protein 7B Thiol S-methyltransferase METTL7B

Cleaved into:

GeneID:366792

Gene names  (primary ):Tmt1b

Gene names  (synonym ):Mettl7b Imported

Gene names  (ORF ):

Length:244

Mass:27,904

Sequence:MDVLVPLLQLLVLLLTLPLHLLALLGCWQPICKTYFPYLMATLTARSYKKMESKKRELFSQIKDLKGTSNEVTLLELGCGTGANFQFYPPGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQEVQRVLKPGGLLFFWEHVSEPQGSQALLWQRVLEPTWKHIGDGCHLTRETWKDIEKAQFSEVQLEWQPPPFKWLPVGPHIMGKAVK

Tissue specificity:Highly expressed in liver and kidney. No expression in testis, heart, lung, brain, spleen or cultured fibroblasts. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp