IPKA_RAT   P63249


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63249

Recommended name:cAMP-dependent protein kinase inhibitor alpha

EC number:

Alternative names:cAMP-dependent protein kinase inhibitor, muscle/brain isoform

Cleaved into:

GeneID:114906

Gene names  (primary ):Pkia

Gene names  (synonym ):

Gene names  (ORF ):

Length:76

Mass:7,960

Sequence:MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDDGQRSSTEQSGEAQGEAAKSES

Tissue specificity:Highest expression in muscle (both skeletal and cardiac) and brain.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp