WDR12_RAT P61480
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61480
Recommended name：Ribosome biogenesis protein WDR12 UniRule Annotation
EC number：
Alternative names：
Cleaved into：
GeneID：363237
Gene names (primary )：Wdr12
Gene names (synonym )：
Gene names (ORF )：
Length：423
Mass：47,563
Sequence：MAQLQARFYTENKKYAVDDVPFSIPATSEVADLSNIINKLLETKNELHKHVEFDFLIKGQFLRMPLVKHMELEDISSEEVVELEYVEKYTAPQPEQCMFHDDWISSIKGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASMDQTILLWEWNIERNKVKALHCCRGHAGSVDAIAVDSSGTKFCSGSWDKMLKIWSTVPTDEEDEIQEPTNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDADEVCSASWDHTVRVWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHDQQLISGSLDNMVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSHVGA
Tissue specificity：
Induction：
Developmental stage：
Protein families：