TAGL3_RAT   P37805


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P37805

Recommended name:Transgelin-3

EC number:

Alternative names:

Cleaved into:

GeneID:63837

Gene names  (primary ):Tagln3

Gene names  (synonym ):Np25

Gene names  (ORF ):

Length:199

Mass:22,501

Sequence:MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRTHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM

Tissue specificity:Abundant and ubiquitous expression in neurons.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp