CRGE_RAT   P02528


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P02528

Recommended name:Gamma-crystallin E

EC number:

Alternative names:

Cleaved into:

GeneID:24279

Gene names  (primary ):Cryge

Gene names  (synonym ):

Gene names  (ORF ):

Length:174

Mass:21,264

Sequence:MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHSSSHRIRIYEREDYRGQMVEITDDCPHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRIMDFY

Tissue specificity:Detected in the superior olivary complex and fibers of the ventral aoustic stria of the auditory hindbrain. 1

Induction:

Developmental stage:

Protein families:beta/gamma-crystallin family


   💬 WhatsApp