RHBL1_RAT O88779
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88779
Recommended name:Rhomboid-related protein 1
EC number:EC:3.4.21.105
Alternative names:RRP
Cleaved into:
GeneID:
Gene names (primary ):Rhbdl1
Gene names (synonym ):Rhbdl
Gene names (ORF ):
Length:164
Mass:17,662
Sequence:FMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFL
Tissue specificity:
Induction:
Developmental stage:
Protein families: