DEFB4_RAT O88514
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88514
Recommended name：Beta-defensin 4
EC number：
Alternative names：BD-2 Defensin, beta 4 RBD-2 RBD-4
Cleaved into：
GeneID：64389
Gene names (primary )：Defb4
Gene names (synonym )：Defb2, Defb3
Gene names (ORF )：
Length：63
Mass：6,946
Sequence：MRIHYLLFSFLLVLLSPLSAFTQSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
Tissue specificity：Highly expressed in lung.
Induction：
Developmental stage：
Protein families：