NET5_RAT D3ZT86
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3ZT86
Recommended name：Netrin-5
EC number：
Alternative names：
Cleaved into：
GeneID：308587
Gene names (primary )：Ntn5
Gene names (synonym )：
Gene names (ORF )：
Length：456
Mass：49,030
Sequence：MADYRTLFSPSGTGSAVTVLVALSLLLLLSQATSDPCYDPGGRPRFCLPPVTQLVGKAAAPCSQTCALPADSPDPVCNGTLTLDLDGSFLLTSVTLRFCTAGPPALVLSAAWAIGGPWRPLWRRPAWPGVLGGPKKVTFHSPPGPKTRIVASYLRVELGGKAGLVTTGVRGRCQCHGHAARCAARAQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHPHPCLPCQCHPIGATGGMCNQTSGQCSCKLGVTGLTCNHCGPGYQQSRSPRMPCQRIPEATTALATTPVASRSDPQCQGYCNVSVSSVHMNLQKYCQQDYVLHARVAESAQVSASSSLSSLSEAVGPEWWRLAVHVLAVFKQRAWPVRRGSQEAWVPRADLSCGCLRLRPGADYLLLGRAAENHTDPAHLILNRHSLALPWRPRWAGPLRRLQQKERGGACRGLLPPTRSPGPRN
Tissue specificity：Expressed in the olfactory bulb, the cerebral cortex, the hippocampus, and the cerebellum in the adult brain (at protein level) (PubMed:25941474). Strongly expressed in the subventricular zone,rostral migrate stream, and the subgranular zone of the dentate gyrus in the hippocampus (PubMed:25941474). 1
Induction：
Developmental stage：
Protein families：