COX42_RAT Q91Y94
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91Y94
Recommended name：Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：84683
Gene names (primary )：Cox4i2
Gene names (synonym )：Cox4b
Gene names (ORF )：
Length：172
Mass：20,170
Sequence：MFSRATRSLVMKTGGLRTQGTHSPGSAASSSQRRMTPYVDCYAQRSYPMPDEPYCTELSEEQRALKEKEKGSWAQLSQAEKVALYRLQFHETFAEMNHRSNEWKTVMGCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLSAHWDYEKKEWKK
Tissue specificity：Highly expressed in lung.
Induction：
Developmental stage：
Protein families：