TR109_RAT Q675B9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q675B9
Recommended name：Taste receptor type 2 member 109
EC number：
Alternative names：Taste receptor type 2 member 38 (T2R38)
Cleaved into：
GeneID：690572
Gene names (primary )：Tas2r109 By Similarity
Gene names (synonym )：Tas2r38
Gene names (ORF )：
Length：320
Mass：37,481
Sequence：MEHFLKSIFDISKNVLPIILFIELIIGIIGNGFMALVHCMDWVKRKKMSLVNQILTTLATSRICLLWFMLLGLLITLLDPDLASARMMIQVASNLWIIANHMSIWLATCLTVFYFLKIANFSSSLFLYLKWRVEKVISVIFLVSLVLLFLNMLLMNLENDMCIAEYHQINISYSFIYHYRADCERRVLRLHIIILSVPFVLSLPTFLLLIFSLWTHHKKMQQHVQGRRDASTTAHFKALQTVIAFLLLYCIFILSMLLQFWKYELMKKPLFILFCHIVYGAFPSFHSYVLILGDMKLRQASLSVLLWLKCRPNYIETLDL
Tissue specificity：
Induction：
Developmental stage：
Protein families：