VOME_RAT Q63751
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63751
Recommended name：Vomeromodulin 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Bpifb9 By Similarity
Gene names (synonym )：RYF3 1 Publication
Gene names (ORF )：
Length：589
Mass：62,793
Sequence：MWVLQALAIMLSIQAGVLDLVEVPPVVRSLPVALPAPVNLPAVLPGSPGLNDPAKNRMLPPKRPGAPSRGGKCAPAARYFLSSDKLQAYLLSILPPQIEDMVKCDKVNMEGVLGDILATMQDSNLLSILDITSLLQGGGGLGLGGLLGKEGNEDPSKPSSGSKATGGLGQLLPEGLPGKEGLGGLLNLGGGKGSGKGLLNGDGLSNVVKPLDDIVENVDSLKAAVQDKVKSVVPENIKDPFSDLLNMDIQETMLKLKVKQVKVGSTDINMGADGIKVLSEVTADVEGEGLLGPVFTLLQFQSVMDVTMNIAVSSNNTQCVNLDVQDTHMHVKEMNIQLLQTVTETVPLPTSLPLNDIIPIVLTAKMNENLEKSDSCGIVLSDFNDCKNTTGLFGYQVHTARISPKGLSIDYCVKANIDNKTVPVPGGRLPPDPKNANVSITTASSALRTLVKYVAKQSSVQMNDLEAQITYIAFAPQENNMLRLLYKVDITKDSQPYATGETKLFISHASKILNSKLVPDVKLTRSEHSVVPPETKEEVEGIMAEVTRKAWSRFNELYKKMSIPDGVSSNTLTNSDVKLLRSNDLQAAS
Tissue specificity：Abundant in the lateral nasal glands (PubMed:1752363, PubMed:1915264). Also present in the posterior septal and vomeronasal glands (PubMed:1752363). 2 s
Induction：
Developmental stage：
Protein families：