CEP41_RAT   Q4KM37


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4KM37

Recommended name:Centrosomal protein of 41 kDa

EC number:

Alternative names:Testis-specific gene A14 protein

Cleaved into:

GeneID:500069

Gene names  (primary ):Cep41

Gene names  (synonym ):Tsga14

Gene names  (ORF ):

Length:339

Mass:36,992

Sequence:MSDSPIDGSPQPEPDYRYKKDELFKRIKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDSDSATSEADTDIAAKTNGKGSPEEQSPSPVQFINSTGAGDASRSTLQSVISGVGELDVDKGLVKKEEPSGKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLVTGSLPASCQQALPFGSVRKRPGPKMPALPAENKWRFTPEDLKKIECYLEADQGPANNPSRLNQNNSAGRDLKVPAGRGGQNLPTGCPTSHSNSRTLNSGHLQGKPWK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp