ST4A1_RAT P63047
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63047
Recommended name：Sulfotransferase 4A1
EC number：EC:2.8.2.-
Alternative names：ST4A1
Cleaved into：
GeneID：58953
Gene names (primary )：Sult4a1
Gene names (synonym )：Sultx3
Gene names (ORF )：
Length：284
Mass：33,054
Sequence：MAESEAETPGTPGEFESKYFEFHGVRLPPFCRGKMEDIADFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDANVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLESLIEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Tissue specificity：Expressed in the brain, not detected in the liver, kidney, spleen, heart, small intestine or testis. 1
Induction：
Developmental stage：Expressed at low levels in brains of 1-day old animals but increase to adult levels from 7-day old animals and remain at that level in adults. 1
Protein families：