O1468_RAT P23274
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23274
Recommended name：Olfactory receptor 1468
EC number：
Alternative names：
Cleaved into：
GeneID：404977
Gene names (primary )：Olr1468
Gene names (synonym )：
Gene names (ORF )：
Length：314
Mass：35,474
Sequence：MTEENQTVISQFLLLGLPIPSEHQHVFYALFLSMYLTTVLGNLIIIILIHLDSHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPFAGCLTQLYFYLYFADLESFLLVAMAYDRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCADNMIPHFFCDISPLLKLSCSDTHVNELVIFVMGGLVIVIPFVLIIVSYARVVASILKVPSVRGIHKIFSTCGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKEALIRVLCKKKITFCL
Tissue specificity：Olfactory epithelium.
Induction：
Developmental stage：
Protein families：