O1082_RAT P23268
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23268
Recommended name：Olfactory receptor 1082
EC number：
Alternative names：
Cleaved into：
GeneID：287002
Gene names (primary )：Olr1082
Gene names (synonym )：
Gene names (ORF )：
Length：317
Mass：35,656
Sequence：MESGNSTRRFSSFFLLGFTENPQLHFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFVDICFTSTTIPKMLVNIYTQSKSITYEDCISQMCVFLVFAELGNFLLAVMAYDRYVAXCHPLCYTVIVNHRLCILLLLLSWVISIFHAFIQSLIVLQLTFCGDVKIPHFFCELNQLSQLTCSDNFPSHLIMNLVPVMLAAISFSGILYSYFKIVSSIHSISTVQGKYKAFSTCASHLSIVSLFYSTGLGVYVSSAVVQSSHSAASASVMYTVVTPMLNPFIYSLRNKDVKRALERLLEGNCKVHHWTG
Tissue specificity：Olfactory epithelium.
Induction：
Developmental stage：
Protein families：