MBNL2_RAT F2Z3T4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:F2Z3T4
Recommended name：Muscleblind-like protein 2
EC number：
Alternative names：
Cleaved into：
GeneID：680445
Gene names (primary )：Mbnl2
Gene names (synonym )：
Gene names (ORF )：
Length：373
Mass：40,156
Sequence：MALNVAPVRDTKWLTLEVCRQYQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPTIGTNAAISFAPYLAPVTPGVGLVPTEVLPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMTQSTAKALKRPLEATVDLAFPPGALHPLPKRQALEKSNGASTVFNPSVLHYQQALTSAQLQQHTAFIPTVPMMHSATSATVSAATTPATSVPFAATATANQIILK
Tissue specificity：Expressed in the cerebellum, pineal gland and skeletal muscle. In the pineal gland, expressed in pinealocytes, not in perivascular spaces (at protein level). 1
Induction：
Developmental stage：Exhibits night/day variations with a 9-fold increased expression at night in the pineal gland (at protein level). A light pulse of 1 hour is sufficient to decrease mRNA levels. Up-regulation is due to a large degree to the release of norepinephrine from nerve terminals in the pineal gland and cAMP signaling pathway. 1
Protein families：