GLIAD_RAT   D3Z9M3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3Z9M3

Recommended name:Gliadoralin-A 1 Publication

EC number:

Alternative names:

Cleaved into:

GeneID:362451

Gene names  (primary ):UP000002494

Gene names  (synonym ):Chromosome 4

Gene names  (ORF ):

Length:109

Mass:12,547

Sequence:MLVILLMVVVLALSSAQDPNRDFVVSSQDVRERQPSSQQGTVGGQSQESQLRDQQQQQSLQQSQEQQPQPQLQQTKQPQRPVKGQPLPQQQQQQNQRPRPRYQQPRRAV

Tissue specificity:Found in saliva (at protein level). Secreted from the submandibular gland. 1

Induction:

Developmental stage:By isoprenaline. Prolongend stimulation does not change the percentages of secreted forms (with gliadoralin A 1-90 as predominant form). 1

Protein families:


   💬 WhatsApp