CMLO1_RAT   Q9QXT4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXT4

Recommended name:N-acetyltransferase 8F1 Curated

EC number:EC:2.3.1.-

Alternative names:Camello-like protein 1 1 Publication Camello-like protein 2 1 Publication GCN5-related N-acetyltransferase 8, family member 1 By Similarity

Cleaved into:

GeneID:59300

Gene names  (primary ):Nat8f1

Gene names  (synonym ):Cml1 By Similarity, Cml2 Imported

Gene names  (ORF ):

Length:221

Mass:24,857

Sequence:MAPYHIRQYQDSDHKSVVDVFTKGMEEHIPSTFRHMLMLPRTLLLLLGVPLALVLVSGSWLLAVVCIFFLLLLLRFLAGQPWKEYVATCLRTDMADITKSYLNAHGSFWVAESGNQVVGIVAALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTLQQGAMTLYLGMGFQKTGQRFLTMFWRLVGIRTIQLKYPFPSA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp