TR107_RAT   Q9JKT9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JKT9

Recommended name:Taste receptor type 2 member 107

EC number:

Alternative names:Taste receptor type 2 member 4 (T2R4)

Cleaved into:

GeneID:78981

Gene names  (primary ):Tas2r107 By Similarity

Gene names  (synonym ):Tas2r10 Imported, Tas2r4

Gene names  (ORF ):

Length:308

Mass:35,052

Sequence:MLSAAEGILLCVVTSEAVLGVLGDTFIALANCMEYAKNKKLSKIGFILIGLAISRIGVVWIIILQGYMQVFFPHILTFGNITEYITYIWVFLNHLSVWFATNLNILYFLKIANFSNSVFLWLKSRVRVVFIFLSGCLLTSWLLCFPQFSKMLNNSKMYWGNTSWLQQQKNVFLINQSLTNLGIFFFIIVSLITCFLLIVFLWRHIRQMHSDGSGLRDLNTEAHVKAMRVLISFAVLFILHFVGLSIQVLCFFLPQNNLLFITGLIATCLYPCGHSIILILGNKQLKQASLKALQHLTCCETKRNLSVT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp